Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Neuroscience
Alternative Names
Aimp2; AIMP2_HUMAN; Aminoacyl tRNA synthase complex-interacting multifunctional protein 2; Aminoacyl tRNA synthetase complex interacting multifunctional protein 2 ; ARS interacting multi functional protein 2 ; JTV 1; JTV 1 protein; JTV1; JTV1 gene; Multisynthase complex auxiliary component p38; Multisynthetase complex auxiliary component p38; P38; PRO0992; Protein JTV 1; Protein JTV-1; tRNA SYNTHETASE COFACTOR p38
Species
Homo sapiens (Human)
Expression Region
1-320aa
Target Protein Sequence
MPMYQVKPYHGGGAPLRVELPTCMYRLPNVHGRSYGPAPGAGHVQEESNLSLQALESRQDDILKRLYELKAAVDGLSKMIQTPDADLDVTNIIQADEPTTLTTNALDLNSVLGKDYGALKDIVINANPASPPLSLLVLHRLLCEHFRVLSTVHTHSSVKSVPENLLKCFGEQNKKQPRQDYQLGFTLIWKNVPKTQMKFSIQTMCPIEGEGNIARFLFSLFGQKHNAVNATLIDSWVDIAIFQLKEGSSKEKAAVFRSMNSALGKSPWLAGNELTVADVVLWSVLQQIGGCSVTVPANVQRWMRSCENLAPFNTALKLLK
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The recombinant human AIMP2 protein is a fusion protein consists of the human AIMP2 protein (1-320aa) partnered with the N-terminal 6xHis tag. It was produced in the E.coli. This recombinant AIMP2 protein's purity is greater than 90% determined by SDS-PAGE. After electrophoresis, there is a 30 kDa protein band presented on the gel.
AIMP2 protein encoded by this gene is part of the aminoacyl-tRNA synthetase complex, which contains nine different aminoacyl-tRNA synthetases and three non-enzymatic factors. The encoded protein is one of the non-enzymatic factors and is required for assembly and stability of the complex. AIMP2 had an inhibitory effect on neoplasms, which could increase the tumor necrosis-induced signaling apoptosis. AIMP2 can directly interact with and activate PARP1. Both AIMP2 and α-synuclein are components of Lewy bodies. Likewise, activated PARP1 can regulate several pathological mechanisms in PD, including the aggregation of α-synuclein, mitochondria dysfunction, and mitophagy dysregulation. AIMP2 also inhibits editing by decreasing ADAR protein levels. Recent evidence indicates that PARP1 activation is a necessary early event in DA neuronal cell death induced by 6-OHDA, consistent with the fact that AIMP2-mediated activation of PARP1 is one of the main causes for the loss of DA neurons.
